<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1081 1081-30708 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y181C, G190S   T39A, K101Q, K122E, D123E, I135V, S162C, S163SC, T200A, L228H  
>1081-30708| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQCCMTKILEPFRKQNPDIVICQYVDDLYVSSDLEIGQHRAKIEELRQHLWRWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54V, V82A, L90M L33F, F53L, G73C L10V, I15V, G16A, K20T, E34Q, M36I, R41K, K55R, R57K, Q61N, L63P, A71V, V77I, I93L  
>1081-30708| codons 4-99
TLWQRPVVTIKVAGQLTEALLDTGADDTIFQEINLPGKWKPKIVGGIGGLVRVKQYDNIP
IEICGHKVICTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006