<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1003 1003-30707 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GA, I54V, V82A, I84V, L90M L33F, Q58E, G73GS L10I, L19I, E34Q, N37P, I62V, L63P, A71V, V77I, Q92K  
>1003-30707| codons 4-99
TLWQRPIVTIKIGGQIKEALLDTGADDTVFQEMPLPGRWKPKMIAGIGGFVKVREYDQVP
IEICGHKVISTVLIGPTPANVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, M184V, L210W, T215Y K219E     E44ED, V118VI, K122E, S162D, V179I, G196E, R211K, L228LH, V245E  
>1003-30707| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006