<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1073 1073-30626 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82F   L10I, I13IV, L19V, K20R, E35D, M36I, N37H, R41K, K45T, K55T, Q61D, I62IV, L63T, I64M, A71V, I72T, V77I, I93L F53C
>1073-30626| codons 4-99
TLWQRPIVTVKIGGQVREALLDTGADDTVLEDIHLPGKWKPTMIGGIGGCATVRQYDDVT
MEICGHKVTGTVLIGPTPFNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F K219Q K103N, Y181C   T39A, S48T, V118I, D123E, Q174R, D177E, H208HY, F214L  
>1073-30626| codons 38-247
CAEMEKEGKITKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEIVICQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGLFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006