<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1072 1072-30625 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, Y115F, M184V, T215Y K219Q G190S   T39M, D123E, I135T, E138A, R172K, D177E, I178L, V179T, D218E K101D
>1072-30625| codons 38-247
CMELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLDKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFKKQNPELTIYQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGFYTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, F53L L10I, I15V, G16E, K20R, E35D, M36I, R41K, K43I, K55R, R57K, Q61D, L63C  
>1072-30625| codons 4-99
TLWQRPIVTIKVEGQLREALIDTGADDTVLEDINLPGKWIPKIIGGIGGLVRVKQYDDIC
IEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006