<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1008 1008-30625 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A L24I, L33F L10V, T12TN, I15V, E35D, M36I, R41K, R57K, Q61N, I62IV, L63P, A71V, I72T  
>1008-30625| codons 4-99
TLWQRPVVNIKVGGQLKEALIDTGADDTVFEDINLPGKWKPKIIGGVGGFVKVKQYDNVP
IEICGHKVTGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     A98G T39S, K43KQ, K122E, I135L, I178M  
>1008-30625| codons 38-247
CSELEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006