<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1069 1069-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74LI, M184V, T215CY V75VA, K219Q K103N   T58TN, V90I, S105AT, K122E, T139KR, S162SN, L210LS  
>1069-30623| codons 38-247
CTEMEKEGKISKIGPENPYNNPVFAIKKKNSDRWRKIADFRELNKRTQDFWEIQLGIPHP
AGLKKNKTVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNERPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLSRWGFYTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A L33F, K43T Q7R, L10I, K20R, E35D, M36I, N37D, I62V, L63P, I64V, A71V, I85V, I93L  
>1069-30623| codons 4-99
TLWRRPIVTIKIGGQLREALLDTGADDTVFEDIDLPGRWTPKMIVGIGGFSKVRQYDQVP
VEICGHKVIGTVLVGPTPANIVGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006