<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1070 1070-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M F53L, G73S L10I, E34Q, I62V, L63P, I66V, A71V, V77I, Q92K  
>1070-30623| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWKPKMIGGIGGLVKVRQYDQVP
IEVCGHKVISTVLIGPTPVNVIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     V60I, T69N, I135T, Q174H, Q207GS, R211K, F214L, K223KT, L228H, V245E F171FV
>1070-30623| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPVRKHNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRSHLLKWGLTTP
DQKHQTEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006