<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1019 1019-30619 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A F53L L10I, I15V, K20R, E35D, M36I, R41K, Q61N, I62IV, L63S, I64L, I72T, T74S, L89M, I93L  
>1019-30619| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIVGIGGLVKVRQYDNVS
LEICGHKATGSVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74IV, T215Y K219E K103N, Y181C   V60VI, D123E, D177E, T200A, D218DE, L228R, V245L  
>1019-30619| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTP
EEKHQKEPPFRWMGYELHPDKWTVQPILLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006