<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1017 1017-30618 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V   K103N   R83K, V90I, K102N, I135V, E138A, S162A, I202IV, R211K, K238KI, V245Q  
>1017-30618| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKKTQDFWEIQLGIPHP
AGLKNNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDIWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84V F53L L10I, K20R, E35D, M36I, N37ND, R41RK, L63P, I66F, A71V  
>1017-30618| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGLVKVRQYDQIP
IEFCGHKVIGTVLVGPTPTNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006