<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1009 1009-30618 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I54IV, V82VAFS   L10I, K14R, I15V, K20KR, E35D, M36I, N37D, R41K, R57K, Q61N, L63D, E65D, I66IV, I72IV, I93L  
>1009-30618| codons 4-99
TLWQRPIVTIRVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIVGIGGFVKVKQYDNID
IDVCGHKAVGTVLVGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, L74V, Y115YF, M184V D67DA, K219KE     T39A, D123DE, I135V, I159IV, S162C, T200A, D218DE  
>1009-30618| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKASTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAFFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AVFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTP
EEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006