Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JCSB1 | B1W48 | Europe | 1994 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+DDC | NA |
| 2 | RTV | 48 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, I54V, V82A, I84V | D30DV | L10I, T31TP, L38LF, L63P, E65D, A71V, V77VI |
| >B1W48| codons 1-99 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYD QIPIDICGHKVIGTVLVGPTPANVIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Schmit, J-C | Resistance-related mutations in the HIV-1 protease gene of patients treated for 1 year with the protease inhibitors ritonavir (ABT-538). | AIDS, 1996 |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |