<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1002 1002-30617 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50IV, I54IV, L90LM G73GC L10I, I15V, L19I, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, I93L  
>1002-30617| codons 4-99
TLWQRPIVTIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGVGGFVKVKQYDNIP
IEICGHKAICTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74LV, T215F K219Q K103KN, Y181YC, G190GA   T39A, V60I, V90I, K122KE, I135V, D218E, L228H, V245VE  
>1002-30617| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006