<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1066 1066-30617 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, D67N, Y115F, Q151M V75I, F77L, F116Y, K219E K101E, Y181C, G190A V179F S68G, K103R, V106I, V118I, K122E, I135T, S163C, Q174R, T200TA, I202V, L210LF, F214L, L228H, V245L, L246LI  
>1066-30617| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKRKNGTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLEKRKSITVLDVGDAFYSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSCMTKILEPFRKRNPDIFICQYMDDLYVASDLEIGQHRAKVEELRQHLFRWGLTTP
DEKHQKEPPFHWMGYELHPDKWTVQPILIP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33I, F53L, G73GS, L89LV L10I, I13V, K20R, E35D, M36I, R41RK, K43E, K55R, R57K, D60K, Q61N, I62V, L63P, A71I, I72E, C95L  
>1066-30617| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVIEDINLPGKWEPKMIGGIGGLVRVKQYKNVP
IEICGHKIESTVLVGPTPANIIGRNVMTQIGLTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006