<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1010 1010-30611 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, K70R, M184V, T215TFIS K219Q K103N, Y181C A98G T69N, V118I, I135T, R211K, F214L, L228R  
>1010-30611| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLSTP
DQKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54M, L90M L10F, L33F, L89V K14R, I15V, K20T, E35N, M36I, A71V, I72T, G73D, I85V, I93L R41Q
>1010-30611| codons 4-99
TLWQRPFVTIRVGGQLTEALLDTGADDTIFENINLPGQWKPKMVGGIGGFMKVRQYDQIL
IEICGHKVTDTVLVGPTPVNIVGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006