<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1063 1063-30612 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54IV, V82A, L90M L33F, F53L, G73GS, N83D L10I, I13V, I15V, K20R, M36I, R41K, Q61N, L63P, A71V, I72T  
>1063-30612| codons 4-99
TLWQRPIVTVKVGGQLREALLDTGADDTIFEEINLPGKWKPKIIGGIGGLVKVRQYDNIP
IEICGHKVTSTVLVGPTPADIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184MV, L210W, T215Y K219R Y188Y*FL   T39TA, E44D, V106VI, V118I, K122E, I135T, S162C, R172RK, G196GE, Q197K, H208Y, K223Q, E224D, L228R  
>1063-30612| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFKKQNPDIVIYQYVDDLLVGSDLEIEKHRTKIEELRQYLWRWGFYTP
DRKHQQDPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006