<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1011 1011-30610 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, L210W, T215DY A62V, D67E, V75T, K219KN K101E, Y181C, G190GA A98G S68G, V118VI, K122KE, I135T, E138A, S162A, R211K  
>1011-30610| codons 38-247
CTELEKEGKISKIGPENPYNTPVFVIKKKEGTKWRKITDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A, L90M L33F, Q58E L10I, I13IV, K20R, L24F, E35D, M36I, N37D, R41K, D60E, I62V, L63P, A71V, I93L  
>1011-30610| codons 4-99
TLWQRPIVTVKIGGQLREALFDTGADDTVFEDIDLPGKWKPKLIGGIGGFLKVREYEQVP
IEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006