<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1006 1006-30609 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S G73C L10I, I15V, G16E, K20R, E35D, M36I, R41E, R57K, Q61N, I62V, I72R, I93L  
>1006-30609| codons 4-99
TLWQRPIVTIKVEGQLREALLDTGADDTVLEDINLPGEWKPKMIVGIGGFVKVKQYDNVL
IEICGHKARCTVLVGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, T215TFIS K219KE Y181YC, G190GA K101KHNQ T39IL, V60VI, S68SG, K122KE, I135V, S162CY, R211RK, L228LH  
>1006-30609| codons 38-247
CLEMEKEGKISKIGPENPYNTPIFAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFSTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006