<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1001 1001-30609 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q Y181YC, Y188L, G190GA K101KHNQ V60VI, K122P, I135T, I142IV, I178IFL, V179VI, G196GE, F214L, L228LH  
>1001-30609| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLIICQYVDDLLVASDLEIEQHRTKIEELRQHLLRWGLFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V L10F, L33I, L89V I13V, M36ML, N37C, K55R, R57RK, L63P, H69Q, A71T, Q92R  
>1001-30609| codons 4-99
TLWQRPFVTVKIGGQLKEALLDTGADDTVIEELCLPGRWKPKLIGGIGGFIRVKQYDQIP
IEICGQKTIGTVLVGPTPVNVIGRNVLTRIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006