<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1005 1005-40615 Argentina 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 53

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, M184V, L210W, T215Y K219E, N348I Y181C V108I, F227L V35M, T39S, E40F, K43E, K101Q, E138Q, G196E, H221Y, L228R, V292I, I293V, I326IV, R356K, R358RK, K390R  
>1005-40615| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICSFLEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPDEKYQKEPPLRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKILKTGKYAKMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82T L33F L10IV, I13V, M36MI, D60E, Q61E, L63P, A71V, T74TA, V77I, L89LM, I93L  
>1005-40615| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVFEEINLPGRWKPKLIVGIGGFTKVRQYE
EIPIEICGHKVIGAVLIGPTPTNIIGRNMLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006