<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1005 1005-30609 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A L33F, Q58QE L10I, D60E, Q61E, L63P, A71V, V77I, I93L  
>1005-30609| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIVGIGGFTKVREYEEIP
IEICGHKVIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, M184V, L210W, T215Y K219E Y181C V108VI, F227L T39S, E40V, K43E, D86E, K101Q, E138EQ, G196E, H221HY, L228R A114AG
>1005-30609| codons 38-247
CSVLEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQEFWEVQLGIPHP
AGLQKKKSVTILDVGDGYFSVPLDKDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTP
DEKYQKEPPLRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006