<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1023 1023-30623 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I, Q58QE L10I, K20KR, L33X, E35DN, M36I, N37E, P39Q, I62V, L63P, A71V, T91S  
>1023-30623| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVFENIELQGRWKPKLIGGIGGFVKVREYDQVP
IEICGHKVIGTVLVGPTPANIIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69DE, L74I, M184V, L210W, T215Y K219R K103KN P225H E44D, D123E, R211K, D218E  
>1023-30623| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSEKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
ERKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006