<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1135 1135-30729 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, Q151M A62AV, V75I, F77L, F116Y, K219KE K101EQ, Y181C, G190A   I135IT, S162SHNR, V245M  
>1135-30729| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFVIKKKNSTKWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQRSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, V82VA L24LI, Q58QE L10I, I62IV, L63PS, I64IV, V77I, I93IL  
>1135-30729| codons 4-99
TLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYDQVS
VEICGHKAIGTVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006