<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1137 1137-30729 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A, L90M L33F L10I, T12V, I13V, E34Q, N37DE, I62V, L63PS, A71I, V77I, I93L  
>1137-30729| codons 4-99
TLWQRPIVVVKIGGQLKEALLDTGADDTVFQEMELPGRWKPKMIVGIGGFSKVRQYDQVS
IEICGHKIIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184MV, L210W, T215Y   K103N, Y181C, G190GA A98G, V179F E44D, D86DN, K101R, K122E, I135V, E194EQ, G196E, H208HY, D218DE, L228LR  
>1137-30729| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQNFWEVQLGIPHP
GGLRKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIFICQYVDDLYVASDLQIEQHRTKIEELRQYLWRWGFYTP
EKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006