<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1136 1136-30729 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82F L33F, K43T, N88D, L89LV L10I, I15V, E35D, M36I, R41K, K55R, R57K, Q61N, L63P, A71V, I85V, I93L  
>1136-30729| codons 4-99
TLWQRPIVTIKVGGQLKEALLDTGADDTVFEDINLPGKWTPKIVGGIGGFVRVKQYDNIP
IEICGHKVIGTVLVGPTPFNIVGRDVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215Y V75M, K219Q L100I, K103N   V60I, D123E, I135V, I142V, I178L, T200A, E203D, H208Y, R211K, D218E  
>1136-30729| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKVMDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRAKIDELRQYLLKWGFYTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006