<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1134 1134-30724 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12K, I15V, G16GE, M36I, N37D, R41K, R57K, Q61N, L63I, I72T, I93L  
>1134-30724| codons 4-99
TLWQRPIVKIKVEGQLKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVKQYDNII
IEICGHKATGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, M184V K219KQ K103N K238T T69TN, I135L, K173N, Q197K, T200E, Q207E, L210F  
>1134-30724| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRNQNPDIVIYQYVDDLYVGSDLEIGKHREKIEELREHLFRWGFTTP
DQKHQKEPPFLWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006