<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1033 1033-30922 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   Y181C, G190GS   E44D, K101Q, K104R, V118I, K122E, D123E, I135V, K173R, V189VI, Q207E, R211K, L228H, V245E  
>1033-30922| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKRSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRRQNPDIVICQYMDDLYISSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L24I, K43T L10I, I15V, K20R, E35D, M36I, N37D, I62V, L63P, A71AV, I72V, T74A  
>1033-30922| codons 4-99
TLWQRPIVTIKVGGQLREALIDTGADDTVLEDIDLPGRWTPKLIGGIGGFVKVRQYDQVP
IEICGHKVVGAVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006