<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1051 1051-30630 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, L74LI, L210W, T215Y K219N K101E, Y181I, G190GS   K43KQ, E44D, V118I, D123E, S162D, V179VI, H208Y, R211K, D218DE, L228H  
>1051-30630| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSNKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIIIIQYMDDLYVSSDLEIGQHRTKIEELRQYLWKWGFYTP
ENKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54T, V82A L33F L10I, L19I, N37CS, L63P, A71V, V77I, L89LIM, I93IL  
>1051-30630| codons 4-99
TLWQRPIVTIKIGGQIKEALLDTGADDTVFEEMSLPGRWKPKLIVGIGGFTKVRQYDQIP
IEICGHKVIGTVLIGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006