<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1192 1192-30929 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50IV, I54V, L76LV, V82A L33LF, Q58E L10IV, G16GE, K20R, E35D, M36I, R41K, K55KR, R57K, Q61N, L63T, E65D, I72T, L89M  
>1192-30929| codons 4-99
TLWQRPVVTIKIEGQLREALLDTGADDTVFEDINLPGKWKPKIIGGVGGFVRVKEYDNIT
IDICGHKATGTVVVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, T215F   Y181C, G190A A98AG, V108VI K101Q, V106VL, I135V, I142V, I178M, V189VI, R211Q, L228R  
>1192-30929| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLQKKKSLTILDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYIASDLEIGQHRTKIEELRQHLLQWGFFTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006