<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1190 1190-30923 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T G73CS L10V, K14R, I15V, K20MR, E35D, M36I, N37ND, R41K, R57K, Q61N, I62V, L63P, I72T, I93L  
>1190-30923| codons 4-99
TLWQRPVVTIRVGGQLREALLDTGADDTVLEDIDLPGKWKPKIIGGIGGFVKVKQYDNVP
IEICGHKATSTVLVGPTPTNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   K103KN A98G T39A, K122E, D123DN, I135L, A158S, I167IV, Q174QK  
>1190-30923| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKVLEPFRKKNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006