<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1166 1166-30903 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75I L100I, K103N   K122P, I135T, I142V, K166R, D177E, V179I, I202V  
>1166-30903| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLIDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIIIYQYMDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54ILM, V82A, I84IV, L90M V11VI, L33F, Q58E L10I, T12K, I13V, L19I, K20R, M36I, N37D, L63P, I72V, L89F  
>1166-30903| codons 4-99
TLWQRPIIKVKIGGQIREALLDTGADDTVFEEIDLPGRWKPKLIGGIGGFMKVREYDQIP
IEICGHKAVGTVLVGPTPANVIGRNFMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006