<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1094 1094-30728 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S, L90M L33F, K43T, G73S L10I, I15V, K20R, E35D, M36I, N37D, R41K, K55R, R57K, Q61D, L63P, A71V, I72T, I85V, I93L  
>1094-30728| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVFEDIDLPGKWTPKIIGGIGGFVRVKQYDDIP
IEICGHKVTSTVLVGPTPSNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215F   K101E, Y181C, G190A   V90I, K122E, I135V, I178M, T200A, K223Q, L228R, V245K  
>1094-30728| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYVASDLEIGQHRAKIEELRQHLLRWGFFTP
DKKHQQEPPFRWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006