<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1084 1084-30714 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   L10V, I15V, K20R, M36I, R41K, R57K, Q61N, L63LAPV, I64L, I85IV, I93L  
>1084-30714| codons 4-99
TLWQRPVVTIKVGGQLREALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVKQYDNIV
LEICGHKAIGTVLVGPTPANIVGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y     V179D V60I, S68SG, V106I, D121C, K122E, I135T, I142V, D177E, L210LS, D218E  
>1084-30714| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSVPLCEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIDIYQYVDDLYVGSDLEIGQHRTKIEELRQHLSRWGFYTP
EKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006