<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1079 1079-30701 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10V, I13V, I15V, K20T, E35D, M36I, R41K, R57K, Q61N, L63P, A71V, T74S, I93L  
>1079-30701| codons 4-99
TLWQRPVVTVKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNIP
IEICGHKVISSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74LV, Y115F V75VI, T215TI, K219Q L100I, K103N   V60VI, K64KN, T69N, V90VI, K122E, I135L, Q174R, V179VI, T200TA, L228R, V245M K46K*
>1079-30701| codons 38-247
CTEMEKEG*ISKIGPENPYNTPIFAINKKDSNRWRKVIDFRELNKRTQDFWEIQLGIPHP
AGIKKNKSVTVLDVGDAFFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIIIYQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFITP
DQKHQKEPPFRWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006