<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1075 1075-30626 Argentina 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, F53L, T74PS L10I, I13V, I15IV, G16A, K20V, E35D, M36I, R41K, K55KR, R57K, Q61N, L63AV, A71V, I93L  
>1075-30626| codons 4-99
TLWQRPIVTVKVAGQLVEALLDTGADDTVFEDINLPGKWKPKMIGGIGGLVRVKQYDNIV
IEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L74V, T215F K219Q K101KE, Y181C, G190GA V108VI T39A, K122KE, D123X, I135IM, S162SC, D177E, D218E  
>1075-30626| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTILDVGDAYFSVPLDEXFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006