<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1015 1015-30618 Argentina 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, V82A L24I, L33F, G73GC L10I, I15V, K20T, E35DN, M36I, R41K, K55R, R57K, Q61N, L63P, I93L  
>1015-30618| codons 4-99
TLWQRPIVTIKVGGQLTEALIDTGADDTVFENINLPGKWKPKIIGGIGGFVRVKQYDNIP
IEICGHKAICTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T215Y   Y181C, G190A K101H T39AE, E44D, V60VI, V90VI, K122E, I135V, I142V, D177N, V179VI, T200A, R211T, D218DE  
>1015-30618| codons 38-247
CEELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLHKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNIIICQYMDDLYVASDLEIGQHRAKIEELRQHLLTWGFYTP
EKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006