<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1607 1607-40518 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, G190A   T27S, V35T, K49R, A98S, K122E, D123N, K166I, D177N, I195L, T200A, R211K, V245E, A272P, K277R, I293V, E297R, A355T, M357T, G359S, K366R, K390R E29EK, K64KE
>1607-40518| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLSEKKIKALTEICTELEKEGKISRIGPENPYNTPV
FAIEKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTIILEPFRKQNPNIVI
YQYVDDLYVASDLELGQHRAKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYTRTRSA
HTNDVRQLTEAVQKIATESIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84IV L33LF I13IV, I15V, K20R, E35D, M36I, N37D, R57K, D60E, I62V, L63P, I64V  
>1607-40518| codons 1-99
PQITLWQRPLVTVKVGGQLREALLDTGADDTVFEDIDLPGRWKPKMIGGIGGFVKVKQYE
QVPVEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006