<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3213 3213-30818 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L33F, G73T L10IT, G16A, L24F, Q61H, I62V, L63P, I66IV, A71V, I72IL, V77I, I93L  
>3213-30818| codons 4-99
TLWQRPTVTIKIAGQLKEALFDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYDHVP
IEVCGHKVLTTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75T, T215F K219E L100I, Y188L   E44D, T69TN, S162SN, G196E, I202IV, E203A, D218DE, K223Q, L228H, V245K  
>3213-30818| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSNRWRKLTDFRELNKRTQDFWEVQLGIPHP
AGIKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYMDDLLVGSDLEIEQHRTKVAELRQHLLRWGFFTP
EEKHQQEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006