<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3102 3102-30610 Canada 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23I, L33F, F53L, Q58E L10I, T12P, I15V, G16E, L19V, K20R, E35D, M36I, N37T, I62V, L63T, H69K, T74A, V82I, I85V, L89M, I93L  
>3102-30610| codons 4-99
TLWQRPIVPIKVEGQVREAILDTGADDTVFEDITLPGRWKPKMIGGIGGLIKVREYDQVT
IEICGKKAIGAVLVGPTPINIVGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R T215I, K219Q K103NS   T39E, S48T, V60I, V90I, K122E, D123S, I135T, K173T, D177E, I178L, V179VI, T200A, E204K, Q207D, R211K, L228H, V245Q  
>3102-30610| codons 38-247
CEEMEKEGKITKIGPENPYNTPIFAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKSKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTQNPELIIYQYMDDLYVGSDLEIGQHRAKIEKLRDHLLKWGFITP
DQKHQKEPPFHWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006