<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3100 3100-30521 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A L10F, L24I, K43T, I54C L19I, K20M, E35N, M36L, N37D, L38W, K55R, R57K, D60E, I62V, L63P, I64V, A71V, I93L  
>3100-30521| codons 4-99
TLWQRPFVTIKIGGQIMEALIDTGADDTVLENLDWPGRWTPKIIGGIGGFCRVKQYEQVP
VEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   Y181YC A98G K43Q, E44D, V118I, K122E, I142V, I178IM, G196E, Q197QE, T200A, E203D, H208Y, R211K, W212M, H221HY, L228H  
>3100-30521| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYVGSDLEIEEHRAKIDELRQYLWKMGFYTP
DKKYQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006