<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3196 3196-30617 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I50V, I54S, V82A L33F L10V, L19LI, E34Q, R41K, I62V, L63P, A71V, T74S, V77I, I93L  
>3196-30617| codons 4-99
TLWQRPVVTIKIGGQIKEALLDTGADDTVFQEMNLPGKWKPKLIVGVGGFSKVRQYDQVP
IEICGHKVIGSVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, V75T, M184V, L210W, T215Y K219E G190Q   K43Q, K64R, V118I, K122E, S162D, V179I, T200A, R211RK, D218E, L228H, V245M V148VE
>3196-30617| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIRKKNSTRWRKITDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNELPQGWKGSP
AIFQDSMTKILEPFRKQNPDIIIYQYVDDLYVQSDLEIGQHRAKIEELRQHLWKWGFYTP
EEKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006