<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3195 3195-30523 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   G190A K101H K43Q, E44D, V118I, E203K, Q207D, R211K, L228Q  
>3195-30523| codons 38-247
CTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVASDLEIGQHRTKIKELRDHLWKWGFYTP
DKKHQKEPPFQWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GA, I54V, V82S L10F, Q58E K20R, E35D, M36I, N37D, D60E, Q61QK, L63P, A71V  
>3195-30523| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIAGIGGFVKVREYEKIP
IEICGHKVIGTVLVGPTPSNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006