<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3029 3029-40406 Canada 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M L10F, G73ST L19IV, K20R, E35ED, M36MI, R41K, K55R, I62V, L63P, A71I, I72LV, V77VI, I85V, I93L  
>3029-40406| codons 4-99
TLWQRPFVTIKIGGQVREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVRVRQYDQVP
IEICGHKIVTTVLIGPTPTNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N   T39N, K43Q, E44D, V60I, V118I, K122E, D123DE, I135V, S162Y, D177N, G196E, R211K, L228Q  
>3029-40406| codons 38-247
CNELEQDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFQWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006