<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3029 3029-30312 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, L90M G73S L10I, L19V, R41K, K55KR, I62IV, L63P, A71I, I72V, V77I, I85V, I93L  
>3029-30312| codons 4-99
TLWQRPIVTIKIGGQVKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFVRVRQYDQVP
IEICGHKIVSTVLIGPTPTNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K103N   T39N, K43Q, E44D, V60I, K102KQ, V118I, K122E, D123DE, I135V, S162Y, D177N, I178IM, G196E, R211K, L228Q  
>3029-30312| codons 38-247
CNELEQDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPNMVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFQWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006