<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3030 3030-30312 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, Q58QE L10I, K20R, M36I, R41K, I62V, L63T, I64V, E65D  
>3030-30312| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVREYDQVT
VDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67G, K219Q K103N   S68G, V90I, K122E, D123N, I135IL, S162SN, V179I, G196E  
>3030-30312| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGTRWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006