<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3025 3025-30306 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90LM Q58E L10I, D60E, Q61E, L63P, A71V, I93L  
>3025-30306| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVREYEEIP
IEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, L210W T215D L100I, K103N   K49R, K122E, I135V, I142IV, E169D, G196E  
>3025-30306| codons 38-247
CTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLWRWGFDTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006