<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3021 3021-30303 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, T215F K219Q     V60I, T69N, K101Q, V118VI, K122E, I135T, K166KR, Q197P, T200A, H208Y, R211K, D218E  
>3021-30303| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSNKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGPHRAKIEELRQYLLKWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F I13V, I15V, K20T, E35D, M36I, I72V, L89I  
>3021-30303| codons 4-99
TLWQRPFVTVKVGGQLTEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFVKVRQYDQIL
IEICGHKAVGTVLVGPTPVNVIGRNIMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006