<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3109 3109-30514 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69TADN, L74V, M184V, L210W, T215Y   Y181C   K43N, E44D, K101Q, K122E, G190X, G196E, E203EK, R211RK, K223Q  
>3109-30514| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKNSNKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVXSDLEIEQHRTKIKELRQHLWKWGFYTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82A, L90M G73S L10I, I15V, Q18QH, K20I, L24LF, E35D, M36I, N37E, R41K, L63P, A71V, I72IL  
>3109-30514| codons 4-99
TLWQRPIVTIKVGGHLIEALFDTGADDTVLEDIELPGKWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006