<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3108 3108-30417 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, I84V, L90M V11I, G73S L10I, I15V, K20M, E35D, M36I, P39T, I62V, L63P, A71V, I72L, I85V  
>3108-30417| codons 4-99
TLWQRPIITIKVGGQLMEALLDTGADDTVLEDINLTGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKVLSTVLVGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N     E44D, K82R, V118I, K122E, I178F, G196E, T200A, E203D, H208Y, R211K, H221HY  
>3108-30417| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNRRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDFVIYQYVDDLYVGSDLEIEQHRAKIDELRQYLWKWGFYTP
DNKYQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006