<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3062 3062-30324 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V, L90M L10FI, V11I, G73S T12TKPQ, I15V, G16A, L19P, K20I, E21ED, M36I, L63P, A71V, I72IM, I85V  
>3062-30324| codons 4-99
TLWQRPIIQIKVAGQPIDALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVMSTVLVGPTPTNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   Y188L V179E T39TA, E44D, K49R, V106I, L109LI, V118I, K122E, I135T, T139I, K166Q, E169D, P170L, R211RK, D218E, K223Q  
>3062-30324| codons 38-247
CAELEKDGKISRIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVIDVGDAYFSIPLDEDFRKYTAFTIPSTNNEIPGIRYQYNVLPQGWKGSP
AIFQSSMTQILDLFRKQNPDIEIYQYVDDLLVGSDLEIGQHRTKIEELRQHLWKWGFYTP
EKKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006