<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-3045 3045-30320 Canada 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50V, V82A L33LF L10V, I13V, K20KQ, E34EQ, M36I, L63P, A71IT, I72V, I93L  
>3045-30320| codons 4-99
TLWQRPVVTVKIGGQLQEALLDTGADDTIFQEINLPGRWKPKIVGGVGGFIKVRQYDQIP
IEICGHKTVGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y       E40F, K43E, V118I, D121H, K122E, S162C, D177E, T200TA, R211K, K223Q, L228R  
>3045-30320| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DKKHQQEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006